PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB01G22010.1
Common NameLOC102719528
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family SBP
Protein Properties Length: 862aa    MW: 96223.7 Da    PI: 7.0152
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB01G22010.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP121.53.8e-38107184178
                   --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
           SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                   +Cqv+gC adls+a++yh+rhkvCe h+k+ vv ++++e+rfCqqCsrfh l+efDe+k+sCr+rLa+hn+rrrk+q+
  OB01G22010.1 107 CCQVDGCLADLSSARDYHKRHKVCELHTKSGVVRIKNIEHRFCQQCSRFHFLQEFDEGKKSCRSRLAQHNRRRRKEQT 184
                   6**************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.7E-29102169IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.086105182IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.88E-35106185IPR004333Transcription factor, SBP-box
PfamPF031101.0E-28108181IPR004333Transcription factor, SBP-box
Gene3DG3DSA:1.25.40.209.7E-5598742IPR020683Ankyrin repeat-containing domain
SuperFamilySSF484033.15E-5630742IPR020683Ankyrin repeat-containing domain
CDDcd002045.03E-4685741No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 862 aa     Download sequence    Send to blast
MSSGLKKKSL EWDLNDWRWD SNLFLATPSN ASTSRCRNRE LGRAEGEIDF GVVDKRRRVS  60
PEEEDDGEGC SNAATTNGDD SWIAVQRERS SEDEMPRKGA CSSSTPCCQV DGCLADLSSA  120
RDYHKRHKVC ELHTKSGVVR IKNIEHRFCQ QCSRFHFLQE FDEGKKSCRS RLAQHNRRRR  180
KEQTQAGLDV NSLNGNHSLS NMLLLLLKQL SGLDSGGSSE QTSGPNYLVN LLKNLSTIAG  240
TQTYQDMVKN TNSVAVPSHA GNNVANGNSV HDPRSPIPVG TESSAEEPTQ KRRMQNFDLN  300
DAYVEEDENR TDKIVFKLFG KEPKDFPANL RAQILNWLSN FPSDIESYIR PGCVILTIYL  360
RLPNWMWDKL AANPAHWIQK LISMSTDALW RTGWMYARVR DQLTLSCNGS LMLVSPWQPI  420
IGNKHQILFI SPIAVACSST VNFSVKGFNI AQPTTKLFCI FGGKYLIQES TEMLLDGTTM  480
QQGPQCLTFS CSFPSTSGRG FIEVEDYDQS SLSFPFVVAE EYVCSEIRTL EHVLNLVSFD  540
DTSEERNDVF TYRDQALRFL QEFGWFLQRI HIRATFETPE DCTEGFPAAR FRWLLSFAVN  600
QEWCAVVKKL LDTLFQGSVD LVGASTVEFV LGQDLVFTAV NKRSKSLIDF LLTYTTNSAP  660
MDRTEGAASV QFLFTPDIAG PSDVTPLHIA ASNSNSVGVL DALTDDPQQL GIKAWKNARD  720
ATGLTPEDYA QKRGHNSYIQ MVQNKIDSRL PKAHVSVPMT GSLSTTDIAE KHSNRSKPTD  780
QIAFDVEKGQ QSAKPPPICR QCLPEPAYRH HANRFLSTRP AVLSLVAIAA VCVCVGLIMQ  840
GPPHIGGMRG PFRWNSLLSG PK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-26102181584squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
15458KRRRV
2176181RRRRKE
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006644087.10.0PREDICTED: squamosa promoter-binding-like protein 1 isoform X2
SwissprotQ9LGU70.0SPL1_ORYSJ; Squamosa promoter-binding-like protein 1
TrEMBLJ3KYZ50.0J3KYZ5_ORYBR; Uncharacterized protein
STRINGOB01G22010.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP19983892
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47070.11e-179squamosa promoter binding protein-like 1